Comparisons of two hemoglogin alpha chain sequences, HAHU & HALUA Using "PROTEIN" alphabet Using "PAM250" scoring scheme. with GAP= -1.00 and NEWGAP= -8.00 The format of the QUERY sequence(s) is NBRF. The format of the LIBRARY sequence(s) is NBRF. Query Sequence: HAHU, with length: 141 (HAHU) Library Sequence: HALUA, with length: 143 (HALUA) Score of global alignment between HAHU and HALUA is 313 Alignment was found between the query sequence (top sequence) and the library sequence (bottom sequence) 1 * * * * * 59 HAHU => V.LSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHF..DLSHGSAQVKGHG : :| | :| ||| : : : |:||| ||| :| ||:||||| |:| : :|| || HALUA => MRFSQDDEVLIKEAWGLL.HQIPNAGGEALARMFSCYPGTKSYFPHFGHDFSANNEKVKHHG 1 * * * * * 61 60 * * * * * 121 HAHU => KKVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPAV ||| ||: ::| |::|::: | :||: ||: | ||| ||: | : :: |:||| ||| : HALUA => KKVVDAIGQGVQHLHDLSSCLHTLSEKHARELMVDPCNFQYLIEAIMTTIAAHYGEKFTPEI 62 * * * * * 123 122 * 141 HAHU => HASLDKFLASVSTVLTSKYR : : :| |: : || | || HALUA => NCAAEKCLGQIVHVLISLYR 124 * 143 The alignment contains: 144 nodes, 61 matches, 79 mismatches and 4 insertions/deletions.