Program PSC MAXSEGS started on July 4,1776 5:00 Finding kringles in plbo. Using "PROTEIN" alphabet Using "PAM40" scoring scheme. (Local search) with GAP= -1.00 and NEWGAP= -30.00 The format of the QUERY sequence(s) is NBRF-PIR. The format of the LIBRARY sequence(s) is NBRF-PIR. Query Sequence: F1-K, with length: 79 (F1-K) Library Sequence: PLBO, with length: 786 (PLBO) ***** Library=PLBO Query=F1-K # 1 scored 159. Alignment was found at query sequence position # 6 (top) and library sequence position # 89 (bottom) 6 * * * * * 65 F1-K => GMNYRGNVSVTRSGIECQLWRSRYPHKPEINSTTHPGADLRENFCRNPDGSITGPWCYTT | ||| |:||: || | || | | | | ||:||||| ||||||| PLBO => GQTYRGTTAETKSGVTCQKWSATSPHVPKFSPEKFPLAGLEENYCRNPDNDENGPWCYTT 89 * * * * * 148 66 79 F1-K => SPTLRREECSVPVC | | : | :| | PLBO => DPDKRYDYCDIPEC 149 162 The alignment contains: 74 nodes, 35 matches, 39 mismatches and 0 insertions/deletions. ***** Library=PLBO Query=F1-K # 2 scored 143. Alignment was found at query sequence position # 1 (top) and library sequence position # 256 (bottom) 1 * * * * * 60 F1-K => CAEGVGMNYRGNVSVTRSGIECQLWRSRYPHKPEINSTTHPGADLRENFCRNPDGSITGP | | | || | | || || || | ||| | :| ||:|||||| | PLBO => CLKGTGKNYGGTVAVTESGHTCQRWSEQTPHKHNRTPENFPCKNLEENYCRNPDGE.KAP 256 * * * * * 314 61 * 79 F1-K => WCYTTSPTLRREECSVPVC ||||| | | |::| | PLBO => WCYTTNSEVRWEYCTIPSC 315 * 333 The alignment contains: 79 nodes, 38 matches, 40 mismatches and 1 insertions/deletions. ***** Library=PLBO Query=F1-K # 3 scored 124. Alignment was found at query sequence position # 1 (top) and library sequence position # 459 (bottom) 1 * * * * * 59 F1-K => CAEGVGMNYRGNVSVTRSGIECQLWRSRYPHKPEI.NSTTHPGADLRENFCRNPDGSITG | | | ||| | |: || | || | |:| | |:|||||| : | PLBO => CMIGTGKSYRGKKATTVAGVPCQEWAAQEPHHHSIFTPETNPQSGLERNYCRNPDGDVNG 459 * * * * * 518 67 F1-K => PWCYTTSP ||||| | PLBO => PWCYTMNP 526 The alignment contains: 68 nodes, 31 matches, 36 mismatches and 1 insertions/deletions. ***** Library=PLBO Query=F1-K # 4 scored 113. Alignment was found at query sequence position # 6 (top) and library sequence position # 363 (bottom) 6 * * * * * 65 F1-K => GMNYRGNVSVTRSGIECQLWRSRYPHKPEINSTTHPGADLRENFCRNPDGSITGPWCYTT | ||| | | :| || | | ||: | | | |:||||| |||||| PLBO => GQSYRGTSSTTITGRKCQSWSSMTPHRHLKTPENYPNAGLTMNYCRNPDAD.KSPWCYTT 363 * * * * * 421 72 F1-K => SPTLRRE | | | PLBO => DPRVRWE 428 The alignment contains: 67 nodes, 31 matches, 35 mismatches and 1 insertions/deletions. ***** Library=PLBO Query=F1-K # 5 scored 100. Alignment was found at query sequence position # 8 (top) and library sequence position # 173 (bottom) 8 * * * * * 67 F1-K => NYRGNVSVTRSGIECQLWRSRYPHKPEINSTTHPGADLRENFCRNPDGSITGPWCYTTSP || | : | || :|| | | || : | :|: |:|||||| |||:|| | PLBO => NYEGKIAKTMSGRDCQAWDSQSPHAHGYIPSKFPNKNLKMNYCRNPDGE.PRPWCFTTDP 173 * * * * * 231 68 79 F1-K => TLRREECSVPVC | | | :| | PLBO => QKRWEFCDIPRC 232 243 The alignment contains: 72 nodes, 32 matches, 39 mismatches and 1 insertions/deletions. ***** Library=PLBO Query=F1-K # 6 scored 27. Alignment was found at query sequence position # 7 (top) and library sequence position # 212 (bottom) 9 F1-K => MNY ||| PLBO => MNY 214 The alignment contains: 3 nodes, 3 matches, 0 mismatches and 0 insertions/deletions.